Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc03g098200.2.1
Common NameLOC101253569
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family HD-ZIP
Protein Properties Length: 722aa    MW: 79358.8 Da    PI: 6.7006
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc03g098200.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
            Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ +++t++q++ Le+ F+++++p++++r +L++ l L  rq+k+WFqNrR+++k
                        678899***********************************************998 PP

               START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         +a  a++el+++++ +ep+W+ks     + +n d + + f+++++       ++ea+r+sgvv+m+   lve ++d + +W e ++    k
                         67899*******************99999999999999999988899**999**************************.************ PP

               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a tlevissg      ++lqlm+ elq+lsplvp R  +f+R+++q ++g+w+ivdvS d +q+++ ss   ++++lpSg+li++++ng+s
                         *****************************************************************98************************ PP

               START 163 kvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         kvtwvehv+++++   h l+r l++sgla+ga +wv tlqr ce+
                         **********987555***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.0222787IPR001356Homeobox domain
SMARTSM003898.2E-172891IPR001356Homeobox domain
CDDcd000861.62E-162988No hitNo description
PfamPF000463.9E-163085IPR001356Homeobox domain
PROSITE patternPS0002706285IPR017970Homeobox, conserved site
PROSITE profilePS5084848.764218456IPR002913START domain
SuperFamilySSF559611.36E-35219454No hitNo description
CDDcd088753.34E-119222452No hitNo description
SMARTSM002346.8E-50227453IPR002913START domain
PfamPF018523.5E-49228453IPR002913START domain
SuperFamilySSF559613.06E-21474711No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2384700.0Solanum lycopersicum chromosome 3 clone C03HBa0298P15, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004235382.10.0PREDICTED: homeobox-leucine zipper protein HDG11
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4BJN50.0K4BJN5_SOLLC; Uncharacterized protein
STRINGSolyc03g098200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84